PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30190.m011278
Common NameRCOM_1689120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family WRKY
Protein Properties Length: 185aa    MW: 21055.8 Da    PI: 9.1895
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30190.m011278genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY97.11.2e-30106164159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDg++WrKYGqK vk+s + rsYYrCt+++C+vkk+++r ++d ++v++tYeg Hnh+
  30190.m011278 106 LDDGFRWRKYGQKAVKNSIHLRSYYRCTHHTCNVKKQIQRLSKDSSIVVTTYEGIHNHP 164
                    59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.7E-3193164IPR003657WRKY domain
SuperFamilySSF1182905.1E-2799165IPR003657WRKY domain
PROSITE profilePS5081126.854101166IPR003657WRKY domain
SMARTSM007745.6E-36106165IPR003657WRKY domain
PfamPF031061.5E-24107164IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MDNGEIPPPL MMTADDILNL NNQSLMPTSL FPSMDQHAIE SQQFASDHID WVSLLSGSFQ  60
FGDQNLTPPT ARDSENAVTN KKKGGRAKKT TPQRISFHTR SADDILDDGF RWRKYGQKAV  120
KNSIHLRSYY RCTHHTCNVK KQIQRLSKDS SIVVTTYEGI HNHPCEKVME SLGPLLRQLQ  180
FLSRI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A4e-2394163271WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002509864.21e-140PREDICTED: probable WRKY transcription factor 43
SwissprotQ8VWQ46e-57WRK56_ARATH; Probable WRKY transcription factor 56
TrEMBLB9RCI01e-139B9RCI0_RICCO; WRKY transcription factor, putative
STRINGGLYMA16G03480.22e-63(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32273471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64000.13e-58WRKY DNA-binding protein 56